What word best describes the tone of this excerpt from "The Fall of the House of Usher" by Edgar Allan Poe?
I looked upon the scene before me-upon the mere house, and the simple landscape features of the domain-upon the bleak walls-upon
the vacant eye-like windows-upon a few rank sedges-and upon a few white trunks of decayed trees-with an utter depression of soul
which I can compare to no earthly sensation more properly than to the after-dream of the reveller upon oplum--the bitter lapse into
everyday life—the hideous dropping off of the vell. There was an iciness, a sinking, a sickening of the heart-an unredeemed dreariness of
thought which no goading of the Imagination could torture into aught of the sublime. What was it-I paused to think-what was it that so
unnerved me in the contemplation of the House of Usher? It was a mystery all Insoluble; nor could I grapple with the shadowy fancies that
crowded upon me as I pondered. I was forced to fall back upon the unsatisfactory conclusion, that while, beyond doubt, there are
combinations of very simple natural objects which have the power of thus affecting us, still, the analysis of this power lies among
considerations beyond our depth. It was possible, I reflected, that a mere different arrangement of the particulars of the scene, of the
details of the picture, would be sufficient to modify, or perhaps to annihilate its capacity for sorrowful Impression; and, acting upon this
idea, I reined my horse to the precipitous brink of a black and lurid tarn that lay in unruffled lustre by the dwelling, and gazed down-but
with a shudder even more thrilling than before-upon the remodelled and Inverted Images of the gray sedge, and the ghastly tree-stems,
and the vacant and eye-like windows.
ОА
admiration
OB.
terror
О с.
hope
OD.
discovery
О Е.
loss

Answers

Answer 1

Answer:

B) Terror

Explanation:

I hope this helps!!

The Fall of the House of Usher is a gothic horror. This scene paints a scary, eerie image for the reader, and therefore I think terror is the most likely correct answer.


Related Questions

Read and classify each selection as a topic or a thesis. Drag the items on the left to the correct location on the right.
topic
thesis

Answers

Answer:

topics

snowboarding

climbing mt Everest

the rest are all categorized as thesis

Hey can you guys help me please!! I need this really bad. What are two overarching messages in the novel Illegal? Please help me. I need lots of help!

Answers

The main "Illegal" messages are the relationships between privilege, power and race. This can be seen in social relations in relation to race, as the story takes place in a universe where white-skinned people have guaranteed citizenship, have power social and economic, the freedom to act as they please, and all the perks that a system can promote. The black population, on the other hand, does not have this citizenship and is devalued, oppressed, exploited and even deported and killed.

"Illegal" presents the story of a society in a fictional country called the Freedom State. Despite the name, the country lives in a system of constant oppression, where the entire society is subject to governmental control, which determines who is legal within the country and those who are illegal and must be fought.

Which statements provide a logical analysis of the call
to action in Queen Elizabeth's speech? Select all that
apply.
The context of awaiting an attack establishes
expectation and adds reasonability.
O The emotional language makes the audience
unlikely to support her request.
The argument builds to the call to action by
establishing the situation and eliciting strong
emotions.
O The failure to establish logos makes the queen's
request seem unreasonable.
O Though the queen asks the troops to risk their lives,
the call is appropriate given a soldier's duty.

Answers

Answer:

A,C,E

Explanation:

edge 2021

Need help with and essssayyyyyyyyy

Answers

Answer:

Essay on a story called "David Copperfield"

The full title of “David Copperfield” is “The Personal History, Adventures, Experience and Observation of David Copperfield the younger of Blunderstone Rookery” but it was never published under this name. “David Copperfield” is the story of a child carrying the same name and his journey from childhood till he grows old.

A sad childhood is portrayed in the story where the child loses his father at a young age. As a result, his mother marries again and his step father gives the little child a very hard time. His step father believes that being weak in studies, David needs full attention. After being frustrated by his father, little David one day bites him. The result is that soon he lands into a hostel where he also faces a hard time but makes two friends- James Steerforth and Tommy Traddles. When he returns home during vacations he comes to know that his mother has given birth to a baby boy. Soon both his mother and the baby boy dies and David is left alone to face the torture of his father. His father now sends David to a factory to work.

David runs away from London to Dover and now meets his relative, Aunt Betsey Trotwood. He is now renamed as Trotwood Copperfield and is addressed by the new nickname Trot everywhere. As he grows up many of his loved ones also leave him alone by kissing death including his Aunt Betsey. At a very young age David faces the pain that people do not face in their lifetimes. This makes him a mature and well to do individual. But life takes a much harder lesson after he gets married to Dora Spenlow because she dies facing the pain of her miscarriage early in their marriage. Later David marries the beautiful and sensible Agnes and lives a beautiful life with her and their three children. He also names his daughter after his late aunt Betsey to show how much he loved her and how much he still misses her.

Is this story okay ??if you want an essay on the story which you read ,then please ask , if I know the story I would try to help

Thank you

in “The Cask of Amontillado,” which statement best infers the value that Montresor places on his reputation?

Answers

Yes i enes resputatoon

Punctuate this:
Its not fair said Angus toms allowed to go,why cant I​

Answers

Answer:

It's not fair, said Angus." Tom's allowed to go, why can't I?"

Remember commas and apostrophes.

How does the text "Cornerstone of Civil Rights" support the idea that racism influenced decisions made in the founding of the United States?

Answers

Answer and Explanation:

The text shows how it was necessary for a constitutional mandate to be created to ensure that the African American population was seen as American citizens and had access to basic rights such as freedom and life. This was the 14th amendment that was created long after the founding of the USA. The text shows that this amendment needed to be created, because the country was formed with a highly racist base, where the concepts of freedoms, rights and social duties were only promoted to the white population, and blacks did not have access to this, as they were considered unworthy, even in a country that has become independent in its quest for freedom and justice.

In other words, "Cornerstone of Civil Rights" shows that it was necessary for the equality and basic rights of the Afro-American population to become a federal law, in order to guarantee that blacks had a minimum quality of life, because the country devalued this population of very intensely at the time of its conception.

1: Do Stan and Jill make a good pair? Tell why you
think so.

Answers

Answer:

uhhh maybe?

Explanation:

I dont know if this is for a class or just like to prove a point but.... I'm going with maybe?

Correct the following sentence for parallelism: Helping with homework, encouraging studies, and a positive attitude are also things parents can participate in.

Answers

Answer:

pqpqpwokekeekpwqpwpskdidenfjvkfkdmekxlsksmnfngngfnfnnfnfkrkrkdkdkdkmfnfkdkslwlqplwlsldndnfnjfnfnfjrkrkrkrkrkkrjfhfhfjdjvnfmckwkxjcnrogivmai

What does the color "gold" represent in the poem ?

This is the poem

Nature’s first green is gold,


Her hardest hue to hold.


Her early leaf’s a flower;


But only so an hour.


Then leaf subsides to leaf.


So Eden sank to grief,


So Dawn goes down to day.

Nothing gold can stay.


This is the option

A. The speaker's greed

B. The speaker's dreams

C. The slow passage of time

D. The fleeting nature of beauty.

Please no links I need help really bad! I know it not C by the way

Answers

Answer:

It is D

Explanation:

This is because he is saying that gold does not stay. The nature of beauty can also relate to this.

And also it is because I got the same question a week ago on my test

Answer:

it is answer D the fleeting nature of beauty

5.
Choose the correct verb form to complete the sentence.

All of the painters _____ bold brush strokes.


A. uses


B. use

Answers

the answer is B. use

The girls (talk) during the class yesterday.
____________________________________________________
b) My sisters (laugh) at my story.
____________________________________________________
c) While he (clean) the house, we (cook).
____________________________________________________
d) It was a lovely day. The sun (shine) and the birds (sing) in the trees.
____________________________________________________
e) I lost my keys when I (walk) home.
____________________________________________________
f) I (knit) sweater when the puppy took away the ball of wool.
____________________________________________________
g) Papa (drink) tea when the newspaper boy arrived.
____________________________________________________
h) Talha (watch) TV when the phone rang.
____________________________________________________
i) Shan (drive) fast when he hit the woman.
____________________________________________________
j) When I woke up, it (rain).
____________________________________________________
k) I (have) dinner when I heard a loud noise.
______________________________
convert into past continious

Answers

Answer:

A) Talked

B) Laughed

C) cooked

D)  Shined

E) walked

F) knitted

G) Drank

H) Watched

I) Drove

J) Rained

K) Had

MARK THIS ANSWER AS BRAINLIEST PLEASE!

The girls were talking during the class yesterday.

My sisters was laughing at my story.

While he was cleaning the house, we were cooking.

It was a lovely day. The sun was shining and the birds were singing in the trees.

I lost my keys when I was walking home.

I was knitting sweater when the puppy took away the ball of wool.

Papa was drinking tea when the newspaper boy arrived.

Talha was watching TV when the phone rang.

Shan was driving fast when he hit the woman.

When I woke up, it was raining.

I was having dinner when I heard a loud noise.

What is the meaning of quetzal?​

Answers

Answer:

Quetzals are a colorful type of bird belonging to the trogon family. They are reportedly said to be found in forests especially in the humid highland regions. These birds usually have red colored bellies, and their heads and back usually colored in green or golden color. Due to the vibrant color scheme possessed by Quetzals, they have been adopted as the national bird of Guatemala. Different Quetzals species have been reportedly found in Mexico, The United States and Guatemala. Quetzals mostly feed on insects, berries and fruits.

Explanation:

Kindly check answer.

Fill in the correct wo A number of girls..... fighting in school. (was, were, have)​

Answers

Answer:

A number of girls "were" fighting in school.

Explanation:

A number of girls was fighting in school.

Pyramus had left a little later than his Thisbe had, and he could see what surely were the tracks of a wild beast left clearly on deep dust. His face grew ashen. And when he had found the bloodstained shawl, he cried: 'Now this same night will see two lovers lose their lives.' —"Pyramus and Thisbe," Ovid Which statement best describes how the order of events heightens tension in this passage? If Pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion. If the lioness had arrived later, she would have encountered Pyramus rather than Thisbe. If Pyramus had arrived earlier, he would have seen the lion attack Thisbe. If Pyramus and Thisbe had arrived at the same time, they would have encountered the lioness together.

Answers

Answer:

Hello, I believe the answer is if pyramus had left at the same time as Thisbe, he might have seen that she was not killed by the lion.

Answer:

A is correct

Explanation:

Got it right on edge

Which of the following is the main reason that eating local food helps the environment? (Please help!!)

A. It travels more miles.
B. It is less nutritious.
C. It is more nutritious.
D. It travels fewer miles.

Answers

Uh I think it could possibly be D

The fundamental reason why consuming locally produced food is beneficial to the environment is given in option (D): " It travels fewer miles"

What are the benefits of eating local food?

Local food helps to keep the local economy afloat because local food does not have to travel as far to reach your plate, it contributes to lowering greenhouse gas (GG) emissions and improving our carbon footprint.

It improves and aids the local economy by supporting local producers, farmers, and other producers.

Check out the link below to learn more about local-food benefits;

https://brainly.com/question/20898394

#SPJ2

He sold many oranges (Passive voice )​

Answers

Many oranges were sold by him

which one is wrong?
a.fly-flew
b.send-sent
c.win-won
d.teach-thought​

Answers

Answer is D. Teach-thought

The students were interviewed by the reporter


Rewrite the sentence using active voice.

Answers

Answer:

The reporter had interviewed the students

the reporter interviewed the students

5 questions with Do and 5 questions with Does english english english plss i dont speak english please help

Answers

Answer:

1. Do you have a book?

2. Do they live here?

3. Do we have a Roku remote?

4. Do we have any milk?

5. Do they really think that's correct?

1. Does anyone have a pencil?

2. Does the pet shop have any crickets?

3. Does anyone know where we are?

4. Does the cafe open at ten or eleven.

5. Does Teresa have a bad back?

Explanation:

Answer:these all end with a question mark

Explanation:

1.do you love people.

2.do you know what time it is?.

3.do chicken fly?

4.do you want to come over?.

5.do the same people always sit.

6.does he have the pen.

7.does she write

8.does he hate gabriella.

9.does jewels know she is mean.

10.does she even read her notes

Read the excerpt from Ovid’s "Pyramus and Thisbe".

Theirs did—indeed they wanted to be wed,
but marriage was forbidden by their parents;
yet there's one thing that parents can't prevent:
the flame of love that burned in both of them.

What story element is most evident in the excerpt?

the characterization of Thisbe
a description of setting
an introduction of theme
the events of the plot

Answers

Answer: C - an introduction of theme

Explanation:

Answer:

an introduction to theme,C

Explanation:

edge 2021

Hi you can help me pliss

Answers

badly = in an unsuccessful way

alright = satisfied/okay

hooray = expresses joy and approval

on the radio = you heard it on the radio

see you soon = will meet again soon

will give correct answer brainliest​

Answers

I think the answer is C sorry if im wrong!

… these things are important not because a high-sounding interpretation can be put upon them but because they are useful. When they become so derivative as to become unintelligible, the same thing may be said for all of us, that we do not admire what we cannot understand —"Poetry," Marianne Moore de riv a tive noun — something based on another source Based on context and the definition above, what does derivative mean in this poem? A. Lacking originality B. Relating to a contract C. Made from another substance D. Something expensive

Answers

Answer:

Lacking Originality

sorry it's late

1st one: A, Lacking Originality

2nd one: B, An unoriginal poem is not worthwhile.

do well; do what you tried to do

Answers

yeah what he said yea

Which statement best expresses the theme of "Wherefore Art Thou Romeo?”

A friend’s genuine help can actually cause one pain.
One must get along with everyone in order to succeed.
Sometimes, one’s weakness can become one’s strength.
In order to succeed, one must have an enemy to focus on.

Answers

A friend’s genuine help can actually cause one pain.

What is Wherefore Art Thou Romeo?

Shakespeare's tragedy Romeo and Juliet features a male lead named Romeo Montague (Italian: Romeo Montecchi).

He secretly loves and marries Juliet, a descendant of the rival House of Capulet, through a priest by the name of Friar Laurence. He is the son of Lord Montague and his wife, Lady Montague.

Romeo, who was exiled after killing Tybalt, Juliet's cousin, in a duel, by mistake, kills himself after learning the truth about Juliet's demise. The character's roots can be found as far back as Pyramus, who occurs in Ovid's Metamorphoses.

Therefore, A friend’s genuine help can actually cause one pain.

To learn more about Romeo, refer to the link:

https://brainly.com/question/19605913

#SPJ7

N . R . Narayan Murthy is a pioneer in which field​

Answers

Answer:

Information Technology

Explanation:

https://en.wikipedia.org/wiki/N._R._Narayana_Murthy

Nagavara Ramarao Narayana Murthy (born 20 August 1946) is an Indian billionaire businessman. He is the founder of Infosys, and has been the chairman, chief executive officer (CEO), president, and chief mentor of the company before retiring and taking the title chairman emeritus.

https://en.wikipedia.org/wiki/Infosys

Infosys Limited is an Indian multinational information technology company that provides business consulting, information technology and outsourcing services.

"Think of all the beauty that’s still left in and around you and be happy."
—from The Diary of Anne Frank by Anne Frank

Even in difficult circumstances, some people focus on the positive aspects of life. Think carefully about this statement.

Write an essay stating your opinion on whether a person can choose to be happy. Be sure to —
• state your position clearly
• use appropriate organization
• provide specific support for your argument
• choose your words carefully
• edit your writing for grammar, mechanics, and spelling


Answers

Answer:

A person can absolutely choose to be happy. It is often easy to look at someone like Anne Frank and say that she was in a situation where one can't be happy. But, Anne Frank has showed us that happiness is not reliant upon circumstance. In incredibly difficult circumstances one has every right to feel negative emotions. The most important thing is that we remember that even though we experience negative emotions we shouldn't let them overrun us. We should accept our circumstances, experience our emotions,and then choose happiness.

How can you show emotion in formal writing?\
by using question marks

by using emoticons

by using exclamation points

by using periods

plsssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss answer with one of the options

Answers

Answer:

by using exclamation points

Explanation:

Formal writings are writing styles adopted for use in professional, academic and other setting which does not involve a personal level of interaction. Therefore, formal writing setup are more organized and guided than informal writings. In formal writeups, there may also be need to show emotions such as excitement, happiness, surprise a d so on. If it were in an in formal setting the use of emoticons would be a very good way to show emotions due to the various emoticon labels available. However, the use of an exclamation mark (!) may be adopted in formal writing to express emotions. In many texts, the use of one (!) rather than three (!!!) is more appropriate for formal writings.

Which of these uses pathos?

Answers

c. makes them feel guilty
Other Questions
3) A bird flies toward a tree limb at a 45-degree angle to the ground along a path that is 50 m long landing on the limb. Determine, in m, how high above the ground the bird is perched. Does anyone know websites for reading Literature only ?( JUST WRITE THE NAME OF THE WEBSITE ) which would have most likely stopped Mendel from finding a pattern in his results Why do some photographers dislike photographing animals Riya has a rectangular garden measuring 12m by 20m that she wanted to split diagonally from corner to corner using a fence. How long does her fence need to be? Give your answer to 1 decimal place. Asha went to visit her grandfather in the village .She found that he was worried about the productivity level of crops for that year. Asha suggested a naturalmethod and asked him to plant crops like pulses, gram and beans for a year and then follow with regular crops.A)What will you name the process suggested by her?B)What could be the reason for the decrease in crop productivity? C)What are the benefits of this process? Hi, sorry about the incomplete page, here's number 4 wix sorry if I wrote ur username Select the question mark. Then choose the sentence thattells what these detall from the play show about Connor. Can someone help me Which statement is true about compare-and-contrast essays?They examine a problem and provide a realistic asolution.They attempt to convince the reader to acceptposition on an issue of concern to the of writer.They attempt to compare the similarities anddifferences between two or more subjects.They examine the relationship between events, explaining how one event or situation causes another. how do you find line segments in angels The expression 6.7\cdot1.45^t6.71.45 t 6, point, 7, dot, 1, point, 45, start superscript, t, end superscript models the number of billions of genetic sequence bases available in the public database of the Whole Genome Shotgun project ttt years since 200220022002. What does 1.451.451, point, 45 represent in this expression? In the accompanying diagram of circle o, chords AB and CDintersect at E. If AE = 3, EB = 4, CE = x, and ED = x +1,find CE AC and BD are perpendiculare bisectors of each other find the perimeter of ABC 30 what is happening in this scene? A government is trying to promote industrialization. It is concerned because the country has few banks able tofinance expensive industrial enterprises. It reaches out towealthy foreign banks and encourages them to fund newfactories and railroads within its borders.Which factor of production is the government described in this passageattempting to develop? A. Capital B entrepreneurshipC LaborD Land what is wrong with consoriacy theories and can a conspiracy theory be damaging to society? how were the Italian Renaissance and the Northern Renaissance similar? My own position on gender based violence Find the value of x. Leave your answer in simplest radical form.